Recombinant Bacillus Thuringiensis Subsp. Kurstaki CRY1AB Protein (1022-1155 aa), His-tagged

Cat.No. : CRY1AB-1624B
Product Overview : Recombinant Bacillus Thuringiensis Subsp. Kurstaki CRY1AB Protein (1022-1155 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bacillus thuringiensis
Source : Yeast
Tag : His
Protein Length : 1022-1155 aa
Description : Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.3 kDa
AA Sequence : HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms cry1Ab; 130 kDa crystal protein; Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b);
UniProt ID P0A370

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRY1AB Products

Required fields are marked with *

My Review for All CRY1AB Products

Required fields are marked with *

0
cart-icon