Recombinant Bovine BMP4 protein, RbFc-tagged
Cat.No. : | BMP4-532B |
Product Overview : | Recombinant Bovine BMP4 protein(Q2KJH1)(294-409aa), fused with N-terminal RbFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | RbFc |
Protein Length : | 294-409aa |
Tag : | N-RbFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
◆ Recombinant Proteins | ||
BMP4-266H | Recombinant Human BMP4 Protein, GST-tagged | +Inquiry |
Bmp4-578TM | Recombinant Murine BMP4 | +Inquiry |
BMP4-1054M | Recombinant Mouse BMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMP4-569H | Recombinant Human BMP4 protein, His & T7-tagged | +Inquiry |
BMP4-570P | Recombinant Pig BMP4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket