Recombinant Bovine CD37 Full Length Transmembrane protein, His-tagged
Cat.No. : | CD37-1482B |
Product Overview : | Recombinant Bovine CD37 protein(Q2KHY8)(1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-280aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MSAHDGCLSLVKYLLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLSFMPLQIWSKVLAVSGILTMGLALLGCVGALKEFRCLLGLYFGTLLLLFATQITLGILISTQRVQLKKKVKDVVQKTIQNYRTHPEETAAEESWDYVQFQLRCCGWESPQDWFHIPSMRRNESEGDRVPCSCYNSSATNDSTIFDKISPQFSRLGSLAQPRHNVEVCSVPANSYIYQQGCERNLSNWLTNNLISIVGICLGVGLLELSFMTLSIFLCRNLDHVYDRLARYR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
CD37-193H | Recombinant Human CD37 Protein, C-His-tagged | +Inquiry |
CD37-10949H | Recombinant Human CD37 protein, His-tagged | +Inquiry |
CD37-70H | Recombinant Human CD37 protein, His-tagged | +Inquiry |
CD37-906R | Recombinant Rat CD37 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD37-1248R | Recombinant Rat CD37 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD37-7678HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD37 Products
Required fields are marked with *
My Review for All CD37 Products
Required fields are marked with *
0
Inquiry Basket