Recombinant Bovine GNAT2 Protein (2-354 aa), His-tagged
Cat.No. : | GNAT2-2424B |
Product Overview : | Recombinant Bovine GNAT2 Protein (2-354 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-354 aa |
Description : | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.0 kDa |
AA Sequence : | GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | GNAT2 G protein subunit alpha transducin 2 [ Bos taurus (cattle) ] |
Official Symbol | GNAT2 |
Synonyms | GNAT2; |
Gene ID | 281795 |
mRNA Refseq | NM_174326 |
Protein Refseq | NP_776751 |
UniProt ID | P04696 |
◆ Recombinant Proteins | ||
Gnat2-1029M | Recombinant Mouse Gnat2 Protein, MYC/DDK-tagged | +Inquiry |
GNAT2-6256C | Recombinant Chicken GNAT2 | +Inquiry |
GNAT2-5337HF | Recombinant Full Length Human GNAT2 Protein, GST-tagged | +Inquiry |
GNAT2-2424B | Recombinant Bovine GNAT2 Protein (2-354 aa), His-tagged | +Inquiry |
GNAT2-5049H | Recombinant Human GNAT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAT2-5865HCL | Recombinant Human GNAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAT2 Products
Required fields are marked with *
My Review for All GNAT2 Products
Required fields are marked with *
0
Inquiry Basket