Recombinant Bovine IGF2 protein(25-91aa), His&Myc-tagged
| Cat.No. : | IGF2-653B |
| Product Overview : | Recombinant Bovine IGF2 protein(P07456)(25-91aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 25-91aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| ◆ Recombinant Proteins | ||
| IGF2-373I | Active Recombinant Human IGF2 Protein (68 aa) | +Inquiry |
| IGF2-819R | Recombinant Rabbit IGF2 protein, His & T7-tagged | +Inquiry |
| IGF2-129H | Recombinant Active Human IGF2 Protein, His-tagged(N-ter) | +Inquiry |
| IGF2-653B | Recombinant Bovine IGF2 protein(25-91aa), His&Myc-tagged | +Inquiry |
| IGF2-28319TH | Recombinant Human IGF2 | +Inquiry |
| ◆ Native Proteins | ||
| IGF2-29116TH | Native Human IGF2 | +Inquiry |
| IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGF2-5267HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
| IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2 Products
Required fields are marked with *
My Review for All IGF2 Products
Required fields are marked with *



