Recombinant Bovine RETN protein, His-SUMO-tagged
Cat.No. : | RETN-3423B |
Product Overview : | Recombinant Bovine RETN protein(Q762I5)(19-109aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-109aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.6 kDa |
AA Sequence : | QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Retn-5467M | Recombinant Mouse Retn Protein, Myc/DDK-tagged | +Inquiry |
RETN-6030H | Recombinant Human RETN Protein (Ser17-Pro108), N-His tagged | +Inquiry |
RETN-1351C | Recombinant Cattle RETN Protein, His-tagged | +Inquiry |
Retn-2015R | Recombinant Rat Retn Protein, His-tagged | +Inquiry |
RETN-7820C | Recombinant Cattle RETN protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *
0
Inquiry Basket