Recombinant Bovine TGFB2 protein, His-tagged
Cat.No. : | TGFB2-8954B |
Product Overview : | Recombinant Bovine TGFB2 protein(P21214)(303-414aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 303-414aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
◆ Recombinant Proteins | ||
TGFB2-377H | Active Recombinant Human Transforming Growth Factor, Beta 2 | +Inquiry |
TGFB2-577H | Active Recombinant Human Transforming Growth Factor, Beta 2 | +Inquiry |
Tgfb2-620M | Active Recombinant Mouse Tgfb2 | +Inquiry |
TGFB2-47H | Active Recombinant Human TGFB2 Protein, Animal Free | +Inquiry |
TGFB2-2893H | Recombinant Human TGFB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB2-1119HCL | Recombinant Human TGFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB2 Products
Required fields are marked with *
My Review for All TGFB2 Products
Required fields are marked with *
0
Inquiry Basket