Recombinant Canine Clusterin, His-tagged

Cat.No. : CLU-1318C
Product Overview : Recombinant Canine Clusterin protein (23-445 aa) with N-His tag was expressed in E. coli.
Availability July 29, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : E.coli
Tag : His
Protein Length : 23-445 aa
Description : This gene encodes a protein that is similar to the human clusterin protein, a secreted chaperone that can also be found in the cell cytosol under certain stress conditions. The human protein has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders.
Form : Lyophilized from PBS, pH7.5
Molecular Mass : 51 kDa
AASequence : MKHHHHHHASDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYHFPIEFPEEDNRTVCKEIRHNSTGCLKMKDQCEKCQEILSVDCSSNNPAQVQLRQELSNSLQIAEKFTKLYDELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLTQSEDPFYLQVTTVGSQTSDSNVPVGFTKVVVKLFDSDPITVMIPEAVSRNNPKFMETVAEKALQEYRQKHREE
Endotoxin : <1 EU/μg by LAL
Purity : >95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Gene Name CLU clusterin [ Canis lupus familiaris (dog) ]
Official Symbol CLU
Synonyms CLU; clusterin; GP80; clusterin; clusterin (complement lysis inhibitor, SP-40,40, sulfated glycoprotein 2, testosterone-repressed prostate message 2, apolipoprotein J); glycoprotein 80
Gene ID 442971
mRNA Refseq NM_001003370
Protein Refseq NP_00100337
UniProt ID P25473

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLU Products

Required fields are marked with *

My Review for All CLU Products

Required fields are marked with *

0
cart-icon
0
compare icon