Recombinant Canine Clusterin, His-tagged
| Cat.No. : | CLU-1318C |
| Product Overview : | Recombinant Canine Clusterin protein (23-445 aa) with N-His tag was expressed in E. coli. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Canine |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-445 aa |
| Description : | This gene encodes a protein that is similar to the human clusterin protein, a secreted chaperone that can also be found in the cell cytosol under certain stress conditions. The human protein has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. |
| Form : | Lyophilized from PBS, pH7.5 |
| Molecular Mass : | 51 kDa |
| AASequence : | MKHHHHHHASDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYHFPIEFPEEDNRTVCKEIRHNSTGCLKMKDQCEKCQEILSVDCSSNNPAQVQLRQELSNSLQIAEKFTKLYDELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLTQSEDPFYLQVTTVGSQTSDSNVPVGFTKVVVKLFDSDPITVMIPEAVSRNNPKFMETVAEKALQEYRQKHREE |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | >95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
| Gene Name | CLU clusterin [ Canis lupus familiaris (dog) ] |
| Official Symbol | CLU |
| Synonyms | CLU; clusterin; GP80; clusterin; clusterin (complement lysis inhibitor, SP-40,40, sulfated glycoprotein 2, testosterone-repressed prostate message 2, apolipoprotein J); glycoprotein 80 |
| Gene ID | 442971 |
| mRNA Refseq | NM_001003370 |
| Protein Refseq | NP_00100337 |
| UniProt ID | P25473 |
| ◆ Recombinant Proteins | ||
| CLU-642G | Recombinant Golden hamster CLU protein, His&Myc-tagged | +Inquiry |
| CLU-746R | Recombinant Rhesus Macaque CLU Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLU-1742H | Recombinant Human CLU Protein (Asp23-Glu449), C-Fc and His tagged | +Inquiry |
| CLU-11356H | Recombinant Human CLU, GST-tagged | +Inquiry |
| Clu-039M | Recombinant Mouse Clu Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CLU-67H | Native Human Clusterin | +Inquiry |
| CLU-19H | Native Human Clusterin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
| CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *



