Recombinant Rat Il13 protein
Cat.No. : | Il13-580R |
Product Overview : | Recombinant Rat Il13 protein (113 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 113 |
Description : | Interleukin-13 (IL-13) is expressed by the IL13 gene and secreted by many cell types, especially T helper type 2 (Th2) cells. The high solution from of IL-13 reported to be a monomer with two internal disulfide bonds that contribute to a bundled four α-helix configuration. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Mature rat IL-13 shares 59 %, 75 %, and 60 % amino acid sequence identity with human, mouse, and rhesus IL-13, respectively. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 113 amino acids. |
AA Sequence : | TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH |
Endotoxin : | Less than 1 EU/μg of rRtIL-13, 113a.a. as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il13 |
Official Symbol | Il13 |
Synonyms | T-cell Activation Protein P600 |
Gene ID | 116553 |
mRNA Refseq | NM_053828 |
Protein Refseq | NP_446280 |
UniProt ID | P42203 |
◆ Recombinant Proteins | ||
IL13-1568C | Active Recombinant Cynomolgus IL13 protein, His-tagged | +Inquiry |
IL13-855D | Recombinant Dog IL13 protein, His & T7-tagged | +Inquiry |
IL13-328H | Active Recombinant Human IL13 | +Inquiry |
Il13-68M | Recombinant Mouse Interleukin 13 | +Inquiry |
IL13-22H | Recombinant Human IL13 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il13 Products
Required fields are marked with *
My Review for All Il13 Products
Required fields are marked with *
0
Inquiry Basket