Recombinant Rat Il13 protein

Cat.No. : Il13-580R
Product Overview : Recombinant Rat Il13 protein (113 a.a.) was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 113
Description : Interleukin-13 (IL-13) is expressed by the IL13 gene and secreted by many cell types, especially T helper type 2 (Th2) cells. The high solution from of IL-13 reported to be a monomer with two internal disulfide bonds that contribute to a bundled four α-helix configuration. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Mature rat IL-13 shares 59 %, 75 %, and 60 % amino acid sequence identity with human, mouse, and rhesus IL-13, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, 5 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 113 amino acids.
AA Sequence : TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Endotoxin : Less than 1 EU/μg of rRtIL-13, 113a.a. as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il13
Official Symbol Il13
Synonyms T-cell Activation Protein P600
Gene ID 116553
mRNA Refseq NM_053828
Protein Refseq NP_446280
UniProt ID P42203

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il13 Products

Required fields are marked with *

My Review for All Il13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon