Recombinant Cervus elaphus PRNP Protein, His-tagged
| Cat.No. : | PRNP-40C |
| Product Overview : | Recombinant Cervus elaphus PRNP Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cervus elaphus |
| Source : | E.coli |
| Tag : | His |
| Description : | prion protein |
| Form : | Supplied as a 0.2 μm filtered solution in PBS, pH8.0. |
| Molecular Mass : | ~17.3KDa |
| AA Sequence : | MGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.11mg/mL |
| Gene Name | LOC122681498 prion protein [ Cervus elaphus (red deer) ] |
| Official Symbol | PRNP |
| Synonyms | PrP; PRNP |
| Gene ID | 122681498 |
| mRNA Refseq | XM_043883659 |
| Protein Refseq | XP_043739594 |
| UniProt ID | P47852 |
| ◆ Recombinant Proteins | ||
| PRNP-373H | Recombinant Human PRNP, Fc-tagged | +Inquiry |
| PRNP-118H | Recombinant Human PRNP Protein, His-tagged | +Inquiry |
| PRNP-13424M | Recombinant Mouse PRNP Protein | +Inquiry |
| PRNP-40C | Recombinant Cervus elaphus PRNP Protein, His-tagged | +Inquiry |
| PRNP-7129M | Recombinant Mouse PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
