Recombinant Cervus elaphus PRNP Protein, His-tagged
Cat.No. : | PRNP-40C |
Product Overview : | Recombinant Cervus elaphus PRNP Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cervus elaphus |
Source : | E.coli |
Tag : | His |
Description : | prion protein |
Form : | Supplied as a 0.2 μm filtered solution in PBS, pH8.0. |
Molecular Mass : | ~17.3KDa |
AA Sequence : | MGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.11mg/mL |
Gene Name | LOC122681498 prion protein [ Cervus elaphus (red deer) ] |
Official Symbol | PRNP |
Synonyms | PrP; PRNP |
Gene ID | 122681498 |
mRNA Refseq | XM_043883659 |
Protein Refseq | XP_043739594 |
UniProt ID | P47852 |
◆ Recombinant Proteins | ||
Prnp-654H | Recombinant Hamster Prnp Protein, His-tagged | +Inquiry |
PRNP-7129M | Recombinant Mouse PRNP Protein, His (Fc)-Avi-tagged | +Inquiry |
Prnp-191H | Recombinant Hamster Prnp Protein | +Inquiry |
Prnp-794H | Recombinant Hamster Prion Protein, His-tagged | +Inquiry |
PRNP-1898H | Recombinant Human Prion Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRNP Products
Required fields are marked with *
My Review for All PRNP Products
Required fields are marked with *
0
Inquiry Basket