Recombinant Chicken TGFB1 protein, His-SUMO-tagged
| Cat.No. : | TGFB1-3568C |
| Product Overview : | Recombinant Chicken TGFB1 protein(P09531)(260-373aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 260-373aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29 kDa |
| AA Sequence : | DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| TGFB1-1250H | Recombinant Human TGFB1 Protein, His-tagged | +Inquiry |
| TGFB1-364H | Recombinant Human TGFB1 protein, Avi-tagged | +Inquiry |
| TGFB1-1051C | Recombinant Canine TGFB1 protein, His-tagged | +Inquiry |
| TGFB1-666HF | Recombinant Full Length Human TGFB1 Protein, GST-tagged | +Inquiry |
| TGFB1-158H | Recombinant Human TGFB1 Protein, Leu30-Arg278, C33S, N-His-Avi tagged, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| TGFB1-051H | Active Recombinant Human TGFB1 Homodimer | +Inquiry |
| TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
| TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
