Recombinant Chicken TNNI2 protein
| Cat.No. : | TNNI2-4786C |
| Product Overview : | Recombinant Chicken TNNI2 protein(P68246)(2-183 aa) was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Chicken |
| Source : | Mammalian Cells |
| Tag : | Non |
| Protein Length : | 2-183 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | SDEEKKRRAATARRQHLKSAMLQLAVTEIEKEAAAKEVEKQNYLAEHCPPLSLPGSMQEL QELCKKLHAKIDSVDEERYDTEVKLQKTNKELEDLSQKLFDLRGKFKRPPLRRVRMSADA MLRALLGSKHKVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAG ES |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| ◆ Recombinant Proteins | ||
| TNNI2-527HF | Recombinant Full Length Human TNNI2 Protein, GST-tagged | +Inquiry |
| TNNI2-1996H | Recombinant Human TNNI2 protein | +Inquiry |
| TNNI2-3332H | Recombinant Human TNNI2, His-tagged | +Inquiry |
| Tnni2-643R | Recombinant Rat Tnni2 protein | +Inquiry |
| TNNI2-30870TH | Recombinant Human TNNI2 | +Inquiry |
| ◆ Native Proteins | ||
| Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNNI2-1802HCL | Recombinant Human TNNI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNI2 Products
Required fields are marked with *
My Review for All TNNI2 Products
Required fields are marked with *
