Recombinant Cyan Fluorescent Protein, His-tagged

Cat.No. : CFP-002E
Product Overview : The recombinant CFP (Cyan Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal CFP fluorescence. Endotoxin has been removed, so the protein is suitable for in vivo injection or cell culture applications. The protein is a 31.3 kDa monomer with 284 amino acids and an N-terminal His-tag, Ex./Em. = 458/480 nm, extinction coefficient 26000M^-1CM^-1.
Fluorescent protein ideal for subcellular labeling/visualization.
Availability August 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Description : Cyan Fluorescent Protein (CFP) is a versatile biological marker for monitoring physiological processes, visualizing protein localization, and detecting transgenic expression in vivo.
Form : Lyophilized (Freeze Dried)
Molecular Mass : 31.3 kDa
AA Sequence : MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR
Endotoxin : <0.1 ng/μg
Purity : ≥97%
Applications : The protein is suitable as a control reagent for CFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of CFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of CFP into cells and tissues, etc. The recombinant CFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP or YFP.
Usage : For Research Use Only! Not to be used in humans
Storage : At -20 centigrade.
At -80 centigrade for long-term storage.
Reconstitution : Reconstitute with dH₂O to 1 mg/mL
Handling : Centrifuge the vial prior to opening.
Synonyms CFP, Cyan Fluorescent Protein

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFP Products

Required fields are marked with *

My Review for All CFP Products

Required fields are marked with *

0
cart-icon