Recombinant Cyan Fluorescent Protein, His-tagged
| Cat.No. : | CFP-002E |
| Product Overview : | The recombinant CFP (Cyan Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal CFP fluorescence. Endotoxin has been removed, so the protein is suitable for in vivo injection or cell culture applications. The protein is a 31.3 kDa monomer with 284 amino acids and an N-terminal His-tag, Ex./Em. = 458/480 nm, extinction coefficient 26000M^-1CM^-1. Fluorescent protein ideal for subcellular labeling/visualization. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His |
| Description : | Cyan Fluorescent Protein (CFP) is a versatile biological marker for monitoring physiological processes, visualizing protein localization, and detecting transgenic expression in vivo. |
| Form : | Lyophilized (Freeze Dried) |
| Molecular Mass : | 31.3 kDa |
| AA Sequence : | MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR |
| Endotoxin : | <0.1 ng/μg |
| Purity : | ≥97% |
| Applications : | The protein is suitable as a control reagent for CFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of CFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of CFP into cells and tissues, etc. The recombinant CFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP or YFP. |
| Usage : | For Research Use Only! Not to be used in humans |
| Storage : | At -20 centigrade. At -80 centigrade for long-term storage. |
| Reconstitution : | Reconstitute with dH₂O to 1 mg/mL |
| Handling : | Centrifuge the vial prior to opening. |
| Synonyms | CFP, Cyan Fluorescent Protein |
| ◆ Recombinant Proteins | ||
| CFP-1179H | Recombinant Human CFP Protein, GST-Tagged | +Inquiry |
| CFP-1352H | Recombinant Human CFP Protein (Gln65-Cys190), N-His tagged | +Inquiry |
| CFP-211R | Recombinant Rhesus monkey CFP protein, His-tagged | +Inquiry |
| CFP-3299HF | Recombinant Full Length Human CFP Protein, GST-tagged | +Inquiry |
| CFP-7679H | Recombinant Human CFP protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CFP-106H | Active Native Human Complement Factor P (Properdin) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFP-7552HCL | Recombinant Human CFP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFP Products
Required fields are marked with *
My Review for All CFP Products
Required fields are marked with *
