Recombinant Cynomolgus monkey BTLA protein, His-Myc-tagged
| Cat.No. : | BTLA-4665C |
| Product Overview : | Recombinant Cynomolgus monkey BTLA protein(A0A2K5W7M7)(31-152 aa), fused with C-terminal His and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus monkey |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 31-152 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 17.7 kDa |
| AASequence : | KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| ◆ Recombinant Proteins | ||
| BTLA-1386H | Recombinant Human BTLA protein(Met1-Thr134), mFc-tagged | +Inquiry |
| BTLA-1148R | Active Recombinant Rat BTLA Protein, Fc-tagged | +Inquiry |
| BTLA-195CAF647 | Active Recombinant Monkey BTLA Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| BTLA-1525R | Recombinant Rhesus Monkey BTLA Protein, hIgG1-tagged | +Inquiry |
| BTLA-8698MF | Recombinant Mouse Btla Protein, hFc-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
| BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *



