Recombinant Cynomolgus monkey BTLA protein, His-Myc-tagged
Cat.No. : | BTLA-4665C |
Product Overview : | Recombinant Cynomolgus monkey BTLA protein(A0A2K5W7M7)(31-152 aa), fused with C-terminal His and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus monkey |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 31-152 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 17.7 kDa |
AASequence : | KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
BTLA-20H | Recombinant Human BTLA Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
BTLA-082H | Recombinant Human BTLA Protein (Lys31-Ser150), C-mFc and 6×His-tagged | +Inquiry |
BTLA-2927H | Active Recombinant Human BTLA protein, Fc-tagged | +Inquiry |
BTLA-001H | Recombinant Human BTLA Protein, His-tagged | +Inquiry |
BTLA-195CAF488 | Active Recombinant Monkey BTLA Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *