Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged

Cat.No. : LEFTY-001C
Product Overview : Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged was expressed in HEK293 cell
Availability August 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Description : Lefty (left-right determination factors) are a class of proteins that are closely related members of the TGF-beta superfamily of growth factors. These proteins are secreted and play a role in left-right asymmetry determination of organ systems during development.[1] Mutations of the genes encoding these proteins have been associated with left-right axis malformations, particularly in the heart and lungs.
Molecular Mass : The protein has a calculated MW of 39.7 kDa.
AA Sequence : LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH
Endotoxin : <1EU/ug by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.25 mg/ml
Storage Buffer : 25mM Tris, 150mM NaCl, pH 8.0.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEFTY1 Products

Required fields are marked with *

My Review for All LEFTY1 Products

Required fields are marked with *

0
cart-icon