| Species : |
Cynomolgus |
| Source : |
HEK293 |
| Tag : |
His |
| Description : |
Lefty (left-right determination factors) are a class of proteins that are closely related members of the TGF-beta superfamily of growth factors. These proteins are secreted and play a role in left-right asymmetry determination of organ systems during development.[1] Mutations of the genes encoding these proteins have been associated with left-right axis malformations, particularly in the heart and lungs. |
| Molecular Mass : |
The protein has a calculated MW of 39.7 kDa. |
| AA Sequence : |
LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH |
| Endotoxin : |
＜1EU/ug by LAL |
| Purity : |
＞90% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
1.25 mg/ml |
| Storage Buffer : |
25mM Tris, 150mM NaCl, pH 8.0. |
