Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged
Cat.No. : | LEFTY-001C |
Product Overview : | Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged was expressed in HEK293 cell |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Description : | Lefty (left-right determination factors) are a class of proteins that are closely related members of the TGF-beta superfamily of growth factors. These proteins are secreted and play a role in left-right asymmetry determination of organ systems during development.[1] Mutations of the genes encoding these proteins have been associated with left-right axis malformations, particularly in the heart and lungs. |
Molecular Mass : | The protein has a calculated MW of 39.7 kDa. |
AA Sequence : | LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH |
Endotoxin : | <1EU/ug by LAL |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.25 mg/ml |
Storage Buffer : | 25mM Tris, 150mM NaCl, pH 8.0. |
◆ Recombinant Proteins | ||
Lefty1-579M | Active Recombinant Mouse Left Right Determination Factor 1 | +Inquiry |
LEFTY1-28C | Recombinant Cynomolgus Monkey LEFTY1, His-tagged | +Inquiry |
Lefty1-629M | Active Recombinant Mouse Lefty1 | +Inquiry |
LEFTY-001C | Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged | +Inquiry |
Lefty1-370M | Recombinant Mouse Lefty1 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *
0
Inquiry Basket