Recombinant Cynomolgus SOD1 Protein, His-tagged
| Cat.No. : | SOD1-956C |
| Product Overview : | Recombinant Cynomolgus SOD1 protein with a His-tag was expressed in E. coli |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Cynomolgus |
| Source : | E.coli |
| Tag : | His |
| Description : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |
| Molecular Mass : | The protein has a calculated MW of 19 kDa. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQHHHHHH |
| Endotoxin : | <1 EU/μg |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.28 mg/mL |
| Storage Buffer : | PBS pH7.4 |
| Gene Name | SOD1 superoxide dismutase 1, soluble [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | SOD1 |
| Synonyms | SOD1; superoxide dismutase 1, soluble; superoxide dismutase [Cu-Zn]; Cu,Zn-superoxide dismutase; superoxide dismutase 1, soluble (amyotrophic lateral sclerosis 1 (adult)); |
| Gene ID | 574096 |
| mRNA Refseq | NM_001032804 |
| Protein Refseq | NP_001027976 |
| UniProt ID | Q8HXQ1 |
| ◆ Recombinant Proteins | ||
| SOD1-2020C | Recombinant Cattle SOD1 protein, His-tagged | +Inquiry |
| SOD1-956C | Recombinant Cynomolgus SOD1 Protein, His-tagged | +Inquiry |
| sod1-1373Z | Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged | +Inquiry |
| SOD1-328H | Recombinant Human SOD1 protein, His/MBP-tagged | +Inquiry |
| SOD1-2495H | Recombinant Human SOD1 protein(71-140 aa), C-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
| SOD1-101B | Active Native Bovine SOD | +Inquiry |
| SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOD1-1576HCL | Recombinant Human SOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOD1 Products
Required fields are marked with *
My Review for All SOD1 Products
Required fields are marked with *
