Recombinant Dictyostelium Discoideum PONA Protein (23-118 aa), His-tagged
| Cat.No. : | PONA-2029D |
| Product Overview : | Recombinant Dictyostelium Discoideum (Slime mold) PONA Protein (23-118 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dictyostelium Discoideum |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-118 aa |
| Description : | Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | ponA; |
| UniProt ID | P54660 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PONA Products
Required fields are marked with *
My Review for All PONA Products
Required fields are marked with *
