Recombinant N. meningitidis ponA Protein, His-SUMO-tagged
| Cat.No. : | ponA-1287N |
| Product Overview : | Recombinant Neisseria meningitidis serogroup B (strain MC58) ponA Protein (206-413aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | N.meningitidis |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 206-413 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 40.0 kDa |
| AA Sequence : | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELY EKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLY TVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | ponA penicillin-binding protein 1 [ Neisseria meningitidis MC58 ] |
| Official Symbol | ponA |
| Synonyms | ponA |
| Gene ID | 903291 |
| Protein Refseq | NP_274804.1 |
| UniProt ID | P0A0Z6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ponA Products
Required fields are marked with *
My Review for All ponA Products
Required fields are marked with *
