Recombinant Dog IL13 protein(19-131aa), His-tagged
| Cat.No. : | IL13-7542D |
| Product Overview : | Recombinant Dog IL13 protein(Q9N0W9)(19-131aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-131aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR |
| Gene Name | IL13 interleukin 13 [ Canis lupus familiaris ] |
| Official Symbol | IL13 |
| Synonyms | IL13; interleukin 13; interleukin-13; IL-13; |
| Gene ID | 442990 |
| mRNA Refseq | NM_001003384 |
| Protein Refseq | NP_001003384 |
| ◆ Recombinant Proteins | ||
| Il13-038I | Active Recombinant Mouse Il13 Protein (111 aa) | +Inquiry |
| IL13-1985P | Recombinant Pig IL13 protein | +Inquiry |
| IL13-1568C | Active Recombinant Cynomolgus IL13 protein, His-tagged | +Inquiry |
| IL13-308C | Active Recombinant Cynomolgus IL13 protein | +Inquiry |
| IL13-234B | Active Recombinant Bovine Interleukin 13 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
| IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
| IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
| IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *



