Recombinant Dog TFF3 protein, His-tagged
Cat.No. : | TFF3-8555D |
Product Overview : | Recombinant Dog TFF3 protein(Q863B4)(24-80aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-80aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 7.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF |
Gene Name | TFF3 trefoil factor 3 (intestinal) [ Canis lupus familiaris ] |
Official Symbol | TFF3 |
Synonyms | TFF3; trefoil factor 3 (intestinal); trefoil factor 3; intestinal trefoil factor; trefoil factor family peptide 3; ITF; |
Gene ID | 403488 |
mRNA Refseq | NM_001002990 |
Protein Refseq | NP_001002990 |
◆ Recombinant Proteins | ||
TFF3-112T | Active Recombinant Human TFF3 Protein (59 aa) | +Inquiry |
TFF3-1758C | Recombinant Cattle TFF3 protein, His & GST-tagged | +Inquiry |
TFF3-31608TH | Recombinant Human TFF3 | +Inquiry |
TFF3-6875D | Recombinant Dog TFF3 protein, His&Myc-tagged | +Inquiry |
Tff3-1762M | Recombinant Mouse Tff3 protein, His & MBP-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFF3 Products
Required fields are marked with *
My Review for All TFF3 Products
Required fields are marked with *
0
Inquiry Basket