Recombinant Dog TFF3 protein, His-tagged

• Cat.No.: TFF3-8555D
• Product Overview: Recombinant Dog TFF3 protein(Q863B4)(24-80aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Dog
• Source: Yeast
• Tag: His
• Protein Length: 24-80aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 7.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Gene Information

• Gene Name: TFF3 trefoil factor 3 (intestinal) [ Canis lupus familiaris ]
• Official Symbol: TFF3
• Synonyms: TFF3; trefoil factor 3 (intestinal); trefoil factor 3; intestinal trefoil factor; trefoil factor family peptide 3; ITF
• Gene ID: 403488
• mRNA Refseq: NM_001002990
• Protein Refseq: NP_001002990