Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 1(Casp1) Protein, His-Tagged
| Cat.No. : | RFL8659AF |
| Product Overview : | Recombinant Full Length Arabidopsis thaliana Casparian strip membrane protein 1(CASP1) Protein (Q9SIH4) (1-206aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Arabidopsis thaliana |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-206) |
| Form : | Lyophilized powder |
| AA Sequence : | MAKESTTIDVGEPSTVTKSSSHVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAIAVT IGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVSIVR PHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQNVST AVVADSIAILFFIVLIIISAIALKRH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CASP1 |
| Synonyms | CASP1; At2g36100; F9C22.3; Casparian strip membrane protein 1; AtCASP1 |
| UniProt ID | Q9SIH4 |
| ◆ Recombinant Proteins | ||
| RFL8659AF | Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 1(Casp1) Protein, His-Tagged | +Inquiry |
| CASP1-7152P | Recombinant Pig CASP1 protein, His-tagged | +Inquiry |
| CASP1-180H | Recombinant Human CASP1 protein, His-tagged | +Inquiry |
| CASP1-0411H | Recombinant Human CASP1 Protein, GST-Tagged | +Inquiry |
| Casp1-0413M | Active Recombinant Mouse Casp1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| CASP1-596H | Active Recombinant Human CASP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
| CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *
