Recombinant Human CASP1 protein, HA-tagged

Cat.No. : CASP1-432H
Product Overview : Recombinant Human CASP1 protein(P29466)(1-91aa), fused with C-terminal HA tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : HA
Protein Length : 1-91aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 11.4 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSA
Gene Name CASP1 caspase 1, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP1
Synonyms CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase 1, apoptosis related cysteine peptidase (interleukin 1, beta, convertase) , caspase 1, apoptosis related cysteine protease (interleukin 1, beta, convertase) , IL1BC; caspase-1; caspase 1; ICE; interleukin 1; beta; convertase; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); P45; IL1BC;
Gene ID 834
mRNA Refseq NM_001223
Protein Refseq NP_001214
MIM 147678
UniProt ID P29466

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP1 Products

Required fields are marked with *

My Review for All CASP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon