Recombinant Full Length Bovine Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged
Cat.No. : | RFL17197BF |
Product Overview : | Recombinant Full Length Bovine Proteinase-activated receptor 1(F2R) Protein (A7YY44) (42-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (42-427) |
Form : | Lyophilized powder |
AA Sequence : | SFFLRNSNDGYEQIPLPEDEDSSEGEFTEDRLSSGNRSSPPQKSPPGFISKSASGYLTSA WLTVFIPSVYTGVFLVSLPLNIMAVVVFVLKMKVKKPAVVYMLHLAAADVLFVCVLPFKI SYYFSGSDWRFGSAMCRFVTAAFYGNMYASIMLMTAISVDRFLAVVYPIQSLSWRTLGRA SFICLAIWAMAIAGVAPLLLQEQATQVPGLNITACHDVLNQTLLEGYYSYYFSAFSAVFF FVPLTLSTVSYVSIIRCLSSSTVANQNKKSRALLLSAAVFCIFILCFGPTNILLLLHYAF LSSDPMTEAAYFAYLLCVCVSSISCCIDPLIYYYASSECQRHLFAILHCKESSDPGSCNS SGQLMPSKMDTCSSNLSSSLYKKLLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F2R |
Synonyms | F2R; PAR1; Proteinase-activated receptor 1; PAR-1; Thrombin receptor |
UniProt ID | A7YY44 |
◆ Recombinant Proteins | ||
F2R-31176TH | Recombinant Human F2R | +Inquiry |
F2R-458H | Recombinant Human F2R Full Length Transmembrane protein(VLPs) | +Inquiry |
F2R-5409M | Recombinant Mouse F2R Protein | +Inquiry |
RFL24143PF | Recombinant Full Length Papio Hamadryas Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged | +Inquiry |
F2R-4158H | Recombinant Fluorescent Human F2R Full Length Transmembrane protein, GFP-tagged(VLPs) | +Inquiry |
◆ Native Proteins | ||
RFL16109HF | Recombinant Full Length Human Proteinase-Activated Receptor 1(F2R) Protein, His tagged | +Inquiry |
F2R-27H | Native Human F2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F2R Products
Required fields are marked with *
My Review for All F2R Products
Required fields are marked with *
0
Inquiry Basket