Recombinant Human F2R
Cat.No. : | F2R-31176TH |
Product Overview : | Recombinant fragment corresponding to amino acids 42-102 of Human Thrombin Receptor with an N terminal proprietary tag; Predicted MWt 32.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 61 amino acids |
Description : | Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response.Proteolytic cleavage leads to the activation of the receptor.F2R is a G-protein coupled receptor family member. |
Molecular Weight : | 32.340kDa inclusive of tags |
Tissue specificity : | Platelets and vascular endothelial cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | F2R coagulation factor II (thrombin) receptor [ Homo sapiens ] |
Official Symbol | F2R |
Synonyms | F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR; |
Gene ID | 2149 |
mRNA Refseq | NM_001992 |
Protein Refseq | NP_001983 |
MIM | 187930 |
Uniprot ID | P25116 |
Chromosome Location | 5q13 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; |
Function | G-protein alpha-subunit binding; G-protein beta-subunit binding; G-protein coupled receptor activity; G-protein coupled receptor activity; protein binding; |
◆ Native Proteins | ||
RFL16109HF | Recombinant Full Length Human Proteinase-Activated Receptor 1(F2R) Protein, His tagged | +Inquiry |
F2R-27H | Native Human F2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F2R Products
Required fields are marked with *
My Review for All F2R Products
Required fields are marked with *
0
Inquiry Basket