Recombinant Human F2R

• Cat.No.: F2R-31176TH
• Product Overview: Recombinant fragment corresponding to amino acids 42-102 of Human Thrombin Receptor with an N terminal proprietary tag; Predicted MWt 32.34 kDa.

Specification

• Description: Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response.Proteolytic cleavage leads to the activation of the receptor.F2R is a G-protein coupled receptor family member.
• Protein length: 61 amino acids
• Molecular Weight: 32.340kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Platelets and vascular endothelial cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
• Tag: Non

Gene Information

• Gene Name: F2R coagulation factor II (thrombin) receptor [ Homo sapiens ]
• Official Symbol: F2R
• Synonyms: F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR
• Gene ID: 2149
• mRNA Refseq: NM_001992
• Protein Refseq: NP_001983
• MIM: 187930
• Uniprot ID: P25116
• Chromosome Location: 5q13
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem
• Function: G-protein alpha-subunit binding; G-protein beta-subunit binding; G-protein coupled receptor activity; G-protein coupled receptor activity; protein binding