Recombinant Human F2R
| Cat.No. : | F2R-31176TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 42-102 of Human Thrombin Receptor with an N terminal proprietary tag; Predicted MWt 32.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 61 amino acids |
| Description : | Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response.Proteolytic cleavage leads to the activation of the receptor.F2R is a G-protein coupled receptor family member. |
| Molecular Weight : | 32.340kDa inclusive of tags |
| Tissue specificity : | Platelets and vascular endothelial cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT |
| Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
| Gene Name | F2R coagulation factor II (thrombin) receptor [ Homo sapiens ] |
| Official Symbol | F2R |
| Synonyms | F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR; |
| Gene ID | 2149 |
| mRNA Refseq | NM_001992 |
| Protein Refseq | NP_001983 |
| MIM | 187930 |
| Uniprot ID | P25116 |
| Chromosome Location | 5q13 |
| Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; |
| Function | G-protein alpha-subunit binding; G-protein beta-subunit binding; G-protein coupled receptor activity; G-protein coupled receptor activity; protein binding; |
| ◆ Recombinant Proteins | ||
| F2R-3011H | Recombinant Human F2R Protein (Ser42-Thr102), N-GST tagged | +Inquiry |
| F2R-3613H | Recombinant Human F2R Protein, GST-tagged | +Inquiry |
| RFL20120RF | Recombinant Full Length Rat Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged | +Inquiry |
| F2R-31176TH | Recombinant Human F2R | +Inquiry |
| F2R-41H | Recombinant Human F2R Full length protein, Flag-tagged | +Inquiry |
| ◆ Native Proteins | ||
| F2R-27H | Native Human F2R Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F2R Products
Required fields are marked with *
My Review for All F2R Products
Required fields are marked with *



