Recombinant Full Length Bovine Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged
Cat.No. : | RFL955BF |
Product Overview : | Recombinant Full Length Bovine Sphingosine 1-phosphate receptor 1(S1PR1) Protein (Q5E9P3) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MGSTRIPLVKALHSPVSDYVNYDIIVRHYNYTGKLKISADKDNGIKLISVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNRFRSFLLISACWVISLILGGLPIM GWNCISTLPSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLGVFIACWAPLFILLLLDVGCKVKTCDILFRTEYFLVLA VLNSGTNPIIYTLSNKEMRRAFVRIMSCCKCPSRDSASKFTRPIIAGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | S1PR1 |
Synonyms | S1PR1; EDG1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363 |
UniProt ID | Q5E9P3 |
◆ Recombinant Proteins | ||
RFL1995HF | Recombinant Full Length Human Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged | +Inquiry |
S1PR1-14628M | Recombinant Mouse S1PR1 Protein | +Inquiry |
S1PR1-7871M | Recombinant Mouse S1PR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
S1pr1-2041M | Recombinant Mouse S1pr1 Protein, His-tagged | +Inquiry |
RFL955BF | Recombinant Full Length Bovine Sphingosine 1-Phosphate Receptor 1(S1Pr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S1PR1-530HCL | Recombinant Human S1PR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S1PR1 Products
Required fields are marked with *
My Review for All S1PR1 Products
Required fields are marked with *
0
Inquiry Basket