Recombinant Human AGTR1 Protein, GST-tagged
Cat.No. : | AGTR1-447H |
Product Overview : | Human AGTR1 partial ORF ( AAH22447, 250 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Multiple alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ] |
Official Symbol | AGTR1 |
Synonyms | AGTR1; angiotensin II receptor, type 1; AGTR1B, angiotensin receptor 1B; type-1 angiotensin II receptor; AG2S; AGTR1A; AT1; AT1B; AT2R1; AT2R1A; AT2R1B; HAT1R; AT1AR; AT1BR; angiotensin receptor 1; angiotensin receptor 1B; angiotensin II type-1 receptor; type-1B angiotensin II receptor; AT1R; AGTR1B; |
Gene ID | 185 |
mRNA Refseq | NM_000685 |
Protein Refseq | NP_000676 |
MIM | 106165 |
UniProt ID | P30556 |
◆ Cell & Tissue Lysates | ||
AGTR1-8970HCL | Recombinant Human AGTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTR1 Products
Required fields are marked with *
My Review for All AGTR1 Products
Required fields are marked with *