Recombinant Human AGTR1 Protein, GST-tagged

Cat.No. : AGTR1-447H
Product Overview : Human AGTR1 partial ORF ( AAH22447, 250 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Multiple alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Jul 2012]
Molecular Mass : 37.73 kDa
AA Sequence : FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ]
Official Symbol AGTR1
Synonyms AGTR1; angiotensin II receptor, type 1; AGTR1B, angiotensin receptor 1B; type-1 angiotensin II receptor; AG2S; AGTR1A; AT1; AT1B; AT2R1; AT2R1A; AT2R1B; HAT1R; AT1AR; AT1BR; angiotensin receptor 1; angiotensin receptor 1B; angiotensin II type-1 receptor; type-1B angiotensin II receptor; AT1R; AGTR1B;
Gene ID 185
mRNA Refseq NM_000685
Protein Refseq NP_000676
MIM 106165
UniProt ID P30556

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGTR1 Products

Required fields are marked with *

My Review for All AGTR1 Products

Required fields are marked with *

0
cart-icon