Recombinant Full Length Callithrix Jacchus Myelin-Oligodendrocyte Glycoprotein(Mog) Protein, His-Tagged
| Cat.No. : | RFL25775CF |
| Product Overview : | Recombinant Full Length Callithrix jacchus Myelin-oligodendrocyte glycoprotein(MOG) Protein (Q29ZQ1) (28-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Callithrix jacchus (White-tufted-ear marmoset) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (28-245) |
| Form : | Lyophilized powder |
| AA Sequence : | GQFRVIGPSHPIQALVGDAAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDGE QAPEYRGRTELLKDDIGEGKVTLKIRNVRFPDEGGFTCFFRDHSYQEEAAMQLKVEDPFY WVSPGVLVLLAVLPVLFLQITVGLVFLYLQHRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MOG |
| Synonyms | MOG; Myelin-oligodendrocyte glycoprotein |
| UniProt ID | Q29ZQ1 |
| ◆ Recombinant Proteins | ||
| Mog-4111M | Recombinant Mouse Mog Protein, Myc/DDK-tagged | +Inquiry |
| Mog-02M | Active Recombinant Mouse Mog Protein, His-tagged | +Inquiry |
| Mog-2445M | Recombinant Mouse Mog protein, hFc-tagged | +Inquiry |
| MOG-641H | Recombinant Human MOG, Fc-tagged | +Inquiry |
| RFL34853PF | Recombinant Full Length Pongo Abelii Myelin-Oligodendrocyte Glycoprotein(Mog) Protein, His-Tagged | +Inquiry |
| ◆ Native Proteins | ||
| MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *
