Recombinant Full Length Chicken Frizzled-7(Fzd7) Protein, His-Tagged
Cat.No. : | RFL19638GF |
Product Overview : | Recombinant Full Length Chicken Frizzled-7(FZD7) Protein (O57329) (32-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (32-567) |
Form : | Lyophilized powder |
AA Sequence : | AHHEDKAISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATAQPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFKEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAGFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVVACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSTGSKGETAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FZD7 |
Synonyms | FZD7; FZ7; Frizzled-7; Fz-7; cFz-7 |
UniProt ID | O57329 |
◆ Recombinant Proteins | ||
FZD7-537H | Active Recombinant Human FZD7 Protein, Fc-tagged | +Inquiry |
FZD7-6121M | Recombinant Mouse FZD7 Protein | +Inquiry |
FZD7-12H | Recombinant Human FZD7 protein, Fc-tagged | +Inquiry |
FZD7-26288TH | Recombinant Human FZD7 | +Inquiry |
Fzd7-54M | Recombinant Mouse Fzd7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD7 Products
Required fields are marked with *
My Review for All FZD7 Products
Required fields are marked with *
0
Inquiry Basket