Recombinant Full Length Chicken Transmembrane Protein 208(Tmem208) Protein, His-Tagged
Cat.No. : | RFL10212GF |
Product Overview : | Recombinant Full Length Chicken Transmembrane protein 208(TMEM208) Protein (Q5ZK32) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MAPKGKAGTKGKKQIFEENRETLRFYLRIILGASAVYAAVNLVVFYPAASAWTWLAFAFS SAVYGASYRSMSSMARPAFADDGSLADGGIDLNMEQGWQSECPHPHEPRHLKDVILLTAM VQVLSCFSLYVWYFWLLAPGRALYLLWVNILGPWFTAESSAPGQEPNEKKQRRTGTPPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM208 |
Synonyms | TMEM208; RCJMB04_13i12; Transmembrane protein 208 |
UniProt ID | Q5ZK32 |
◆ Recombinant Proteins | ||
TMEM208-4594C | Recombinant Chicken TMEM208 | +Inquiry |
RFL14577XF | Recombinant Full Length Xenopus Laevis Transmembrane Protein 208(Tmem208) Protein, His-Tagged | +Inquiry |
TMEM208-4805R | Recombinant Rhesus monkey TMEM208 Protein, His-tagged | +Inquiry |
RFL27643DF | Recombinant Full Length Dictyostelium Discoideum Transmembrane Protein 208 Homolog(Tmem208) Protein, His-Tagged | +Inquiry |
TMEM208-16989M | Recombinant Mouse TMEM208 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM208-967HCL | Recombinant Human TMEM208 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM208 Products
Required fields are marked with *
My Review for All TMEM208 Products
Required fields are marked with *