Recombinant Full Length Dog Cd40 Ligand(Cd40Lg) Protein, His-Tagged
Cat.No. : | RFL31088CF |
Product Overview : | Recombinant Full Length Dog CD40 ligand(CD40LG) Protein (O97626) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLYEDFVFMKTLQKCNKGEGSLSLLNCEEIKSQFEAFLKEIMLNNEMKKEENIAMQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLAVKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSRGSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD40LG |
Synonyms | CD40LG; CD40L; TNFSF5; CD40 ligand; CD40-L; Tumor necrosis factor ligand superfamily member 5; CD antigen CD154 |
UniProt ID | O97626 |
◆ Recombinant Proteins | ||
Cd40lg-545RAF555 | Recombinant Rat Cd40lg Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD40lg-83M | Recombinant Mouse CD40lg protein, His-tagged | +Inquiry |
Cd40lg-405R | Active Recombinant Rat Cd40lg, FLAG-tagged | +Inquiry |
CD40LG-280HF | Active Recombinant Human CD40LG Protein, Fc/Avi-tagged, Biotinylated, FITC conjugated | +Inquiry |
CD40LG-019E | Active Recombinant Human CD40LG (108-261aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40LG-1548MCL | Recombinant Mouse CD40LG cell lysate | +Inquiry |
CD40LG-1965HCL | Recombinant Human CD40LG cell lysate | +Inquiry |
CD40LG-1080CCL | Recombinant Cynomolgus CD40LG cell lysate | +Inquiry |
CD40LG-001CCL | Recombinant Canine CD40LG cell lysate | +Inquiry |
CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40LG Products
Required fields are marked with *
My Review for All CD40LG Products
Required fields are marked with *
0
Inquiry Basket