Recombinant Full Length Dog E-Selectin(Sele) Protein, His-Tagged
Cat.No. : | RFL6137CF |
Product Overview : | Recombinant Full Length Dog E-selectin(SELE) Protein (P33730) (23-611aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-611) |
Form : | Lyophilized powder |
AA Sequence : | WSYNASTEAMTFDEASTYCQQRYTHLVAIQNQEEIKYLNSMFTYTPTYYWIGIRKVNKKWTWIGTQKLLTEEAKNWAPGEPNNKQNDEDCVEIYIKRDKDSGKWNDERCDKKKLALCYTAACTPTSCSGHGECVETVNNYTCKCHPGFRGLRCEQVVTCQAQEAPEHGSLVCTHPLGTFSYNSSCFVSCDKGYLPSSTEATQCTSTGEWSASPPACNVVECSALTNPCHGVMDCLQSSGNFPWNMTCTFECEEGFELMGPKRLQCTSSGNWDNRKPTCKAVTCGAIGHPQNGSVSCSHSPAGEFSVRSSCNFTCNEGFLMQGPAQIECTAQGQWSQQVPVCKASQCKALSSPERGYMSCLPGASGSFQSGSSCEFFCEKGFVLKGSKTLQCGLTGKWDSEEPTCEAVKCDAVQQPQDGLVRCAHSSTGEFTYKSSCAFSCEEGFELHGSAQLECTSQGQGVTGGPSCQVVQCFKSGSFRKDEHKLQGEPVFGAVCAFACPEGWTLNGSAALMCDATGHWSGMLPTCEAPTESSIPLAVGLTAGGTSLLTVASFLLWLLKRLRKRAKKFVPASSCQSLQSDGSYHMPCSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SELE |
Synonyms | SELE; E-selectin; CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD antigen CD62E |
UniProt ID | P33730 |
◆ Recombinant Proteins | ||
SELE-581H | Recombinant Human SELE protein, His-Avi-tagged | +Inquiry |
SELE-5513P | Recombinant Pig SELE protein, His-tagged | +Inquiry |
RFL22559BF | Recombinant Full Length Bovine E-Selectin(Sele) Protein, His-Tagged | +Inquiry |
SELE-151H | Recombinant Human SELE Protein, DYKDDDDK-tagged | +Inquiry |
Sele-1720M | Recombinant Mouse Selectin, Endothelial Cell, Fc-His | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELE-2992HCL | Recombinant Human SELE cell lysate | +Inquiry |
SELE-845MCL | Recombinant Mouse SELE cell lysate | +Inquiry |
SELE-1099CCL | Recombinant Cynomolgus SELE cell lysate | +Inquiry |
SELE-960RCL | Recombinant Rat SELE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELE Products
Required fields are marked with *
My Review for All SELE Products
Required fields are marked with *
0
Inquiry Basket