Recombinant Full Length Dog Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1 Homolog(Mcl1) Protein, His-Tagged
Cat.No. : | RFL18182CF |
Product Overview : | Recombinant Full Length Dog Induced myeloid leukemia cell differentiation protein Mcl-1 homolog(MCL1) Protein (Q8HYS5) (1-350aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-350) |
Form : | Lyophilized powder |
AA Sequence : | MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGGGEAGAVIGGS AGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MCL1 |
Synonyms | MCL1; Induced myeloid leukemia cell differentiation protein Mcl-1 homolog |
UniProt ID | Q8HYS5 |
◆ Recombinant Proteins | ||
MCL1-779H | Recombinant Human MCL1, His-tagged | +Inquiry |
MCL1-2522R | Recombinant Rhesus Macaque MCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCL1-781H | Recombinant Human MCL1, His-tagged | +Inquiry |
MCL1-5408M | Recombinant Mouse MCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCL1-5820H | Recombinant Human MCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCL1-4422HCL | Recombinant Human MCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCL1 Products
Required fields are marked with *
My Review for All MCL1 Products
Required fields are marked with *