Recombinant Full Length Human ACTC1 Protein, C-Flag-tagged
Cat.No. : | ACTC1-1209HFL |
Product Overview : | Recombinant Full Length Human ACTC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.8 kDa |
AA Sequence : | MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Full Length : | Full L. |
Gene Name | ACTC1 actin alpha cardiac muscle 1 [ Homo sapiens (human) ] |
Official Symbol | ACTC1 |
Synonyms | ACTC; ASD5; CMD1R; CMH11; LVNC4 |
Gene ID | 70 |
mRNA Refseq | NM_005159.5 |
Protein Refseq | NP_005150.1 |
MIM | 102540 |
UniProt ID | P68032 |
◆ Recombinant Proteins | ||
Actc1-3089M | Recombinant Mouse Actc1, His-tagged | +Inquiry |
ACTC1-283M | Recombinant Mouse ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTC1-1241M | Recombinant Mouse ACTC1 Protein | +Inquiry |
ACTC1-818HF | Recombinant Full Length Human ACTC1 Protein, GST-tagged | +Inquiry |
ACTC1-244H | Recombinant Human ACTC1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTC1-9065HCL | Recombinant Human ACTC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTC1 Products
Required fields are marked with *
My Review for All ACTC1 Products
Required fields are marked with *
0
Inquiry Basket