Recombinant Full Length Human AK2 Protein, C-Flag-tagged
Cat.No. : | AK2-302HFL |
Product Overview : | Recombinant Full Length Human AK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI DASQTPDVVFASILAAFSKATCKDLVMFITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Purine metabolism |
Full Length : | Full L. |
Gene Name | AK2 adenylate kinase 2 [ Homo sapiens (human) ] |
Official Symbol | AK2 |
Synonyms | ADK2 |
Gene ID | 204 |
mRNA Refseq | NM_001625.4 |
Protein Refseq | NP_001616.1 |
MIM | 103020 |
UniProt ID | P54819 |
◆ Recombinant Proteins | ||
AK2-685H | Recombinant Human AK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AK2-302HFL | Recombinant Full Length Human AK2 Protein, C-Flag-tagged | +Inquiry |
AK2-239R | Recombinant Rat AK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK2-1345H | Recombinant Human AK2, His & GST tagged | +Inquiry |
AK2-283R | Recombinant Rhesus monkey AK2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK2-508HCL | Recombinant Human AK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AK2 Products
Required fields are marked with *
My Review for All AK2 Products
Required fields are marked with *
0
Inquiry Basket