Recombinant Full Length Human AKR1A1 Protein, C-Flag-tagged
Cat.No. : | AKR1A1-626HFL |
Product Overview : | Recombinant Full Length Human AKR1A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.4 kDa |
AA Sequence : | MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | AKR1A1 aldo-keto reductase family 1 member A1 [ Homo sapiens (human) ] |
Official Symbol | AKR1A1 |
Synonyms | ALR; ARM; DD3; ALDR1; HEL-S-6 |
Gene ID | 10327 |
mRNA Refseq | NM_153326.3 |
Protein Refseq | NP_697021.1 |
MIM | 103830 |
UniProt ID | P14550 |
◆ Recombinant Proteins | ||
AKR1A1-5474H | Recombinant Human AKR1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AKR1A1-4567H | Recombinant Human AKR1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AKR1A1-303H | Recombinant Human AKR1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1A1-408H | Recombinant Human AKR1A1 Protein, GST-tagged | +Inquiry |
AKR1A1-251R | Recombinant Rat AKR1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1A1-8932HCL | Recombinant Human AKR1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1A1 Products
Required fields are marked with *
My Review for All AKR1A1 Products
Required fields are marked with *
0
Inquiry Basket