Recombinant Full Length Human ANAPC15 Protein, GST-tagged

Cat.No. : ANAPC15-1824HF
Product Overview : Human C11orf51 full-length ORF (AAH05156.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 121 amino acids
Description : Involved in regulation of mitotic cell cycle spindle assembly checkpoint. Part of anaphase-promoting complex.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.71 kDa
AA Sequence : MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANAPC15 anaphase promoting complex subunit 15 [ Homo sapiens ]
Official Symbol ANAPC15
Synonyms APC15; HSPC020; C11orf51
Gene ID 25906
mRNA Refseq NM_014042.2
Protein Refseq NP_054761.1
MIM 614717
UniProt ID P60006

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC15 Products

Required fields are marked with *

My Review for All ANAPC15 Products

Required fields are marked with *

0
cart-icon
0
compare icon