Recombinant Full Length Human ANAPC15 Protein, GST-tagged
Cat.No. : | ANAPC15-1824HF |
Product Overview : | Human C11orf51 full-length ORF (AAH05156.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 121 amino acids |
Description : | Involved in regulation of mitotic cell cycle spindle assembly checkpoint. Part of anaphase-promoting complex. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 39.71 kDa |
AA Sequence : | MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANAPC15 anaphase promoting complex subunit 15 [ Homo sapiens ] |
Official Symbol | ANAPC15 |
Synonyms | APC15; HSPC020; C11orf51 |
Gene ID | 25906 |
mRNA Refseq | NM_014042.2 |
Protein Refseq | NP_054761.1 |
MIM | 614717 |
UniProt ID | P60006 |
◆ Recombinant Proteins | ||
ANAPC15-1824HF | Recombinant Full Length Human ANAPC15 Protein, GST-tagged | +Inquiry |
ANAPC15-320R | Recombinant Rhesus monkey ANAPC15 Protein, His-tagged | +Inquiry |
ANAPC15-366H | Recombinant Human ANAPC15 Protein (1-121 aa), GST-tagged | +Inquiry |
ANAPC15-4395Z | Recombinant Zebrafish ANAPC15 | +Inquiry |
ANAPC15-664R | Recombinant Rat ANAPC15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANAPC15 Products
Required fields are marked with *
My Review for All ANAPC15 Products
Required fields are marked with *
0
Inquiry Basket