Recombinant Human ANAPC15 Protein, GST-tagged
| Cat.No. : | ANAPC15 -471H |
| Product Overview : | Human C11orf51 full-length ORF (AAH05156.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 39.71 kDa |
| AA Sequence : | MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANAPC15 anaphase promoting complex subunit 15 [ Homo sapiens ] |
| Official Symbol | ANAPC15 |
| Synonyms | APC15; HSPC020; C11orf51 |
| Gene ID | 25906 |
| mRNA Refseq | NM_014042.2 |
| Protein Refseq | NP_054761.1 |
| MIM | 614717 |
| UniProt ID | P60006 |
| ◆ Recombinant Proteins | ||
| ANAPC15-4395Z | Recombinant Zebrafish ANAPC15 | +Inquiry |
| ANAPC15-148R | Recombinant Rhesus Macaque ANAPC15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANAPC15-366H | Recombinant Human ANAPC15 Protein (1-121 aa), GST-tagged | +Inquiry |
| ANAPC15-320R | Recombinant Rhesus monkey ANAPC15 Protein, His-tagged | +Inquiry |
| ANAPC15-664R | Recombinant Rat ANAPC15 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC15 Products
Required fields are marked with *
My Review for All ANAPC15 Products
Required fields are marked with *
