Recombinant Human ANAPC15 Protein (1-121 aa), GST-tagged

Cat.No. : ANAPC15-366H
Product Overview : Recombinant Human ANAPC15 Protein (1-121 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-121 aa
Description : Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assbly checkpoint. Also required for degradation of CDC20.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 41.3 kDa
AA Sequence : MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name ANAPC15 anaphase promoting complex subunit 15 [ Homo sapiens ]
Official Symbol ANAPC15
Synonyms APC15; HSPC020; C11orf51
Gene ID 25906
mRNA Refseq NM_014042.2
Protein Refseq NP_054761.1
MIM 614717
UniProt ID P60006

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC15 Products

Required fields are marked with *

My Review for All ANAPC15 Products

Required fields are marked with *

0
cart-icon