Recombinant Human ANAPC15 Protein (1-121 aa), GST-tagged
Cat.No. : | ANAPC15-366H |
Product Overview : | Recombinant Human ANAPC15 Protein (1-121 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-121 aa |
Description : | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating in the responsiveness of the spindle assbly checkpoint. Also required for degradation of CDC20. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 41.3 kDa |
AA Sequence : | MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ANAPC15 anaphase promoting complex subunit 15 [ Homo sapiens ] |
Official Symbol | ANAPC15 |
Synonyms | APC15; HSPC020; C11orf51 |
Gene ID | 25906 |
mRNA Refseq | NM_014042.2 |
Protein Refseq | NP_054761.1 |
MIM | 614717 |
UniProt ID | P60006 |
◆ Recombinant Proteins | ||
ANAPC15-664R | Recombinant Rat ANAPC15 Protein | +Inquiry |
ANAPC15-148R | Recombinant Rhesus Macaque ANAPC15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANAPC15-366H | Recombinant Human ANAPC15 Protein (1-121 aa), GST-tagged | +Inquiry |
ANAPC15 -471H | Recombinant Human ANAPC15 Protein, GST-tagged | +Inquiry |
ANAPC15-320R | Recombinant Rhesus monkey ANAPC15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC15 Products
Required fields are marked with *
My Review for All ANAPC15 Products
Required fields are marked with *
0
Inquiry Basket