Recombinant Full Length Human AP2S1 Protein, Flag tagged

• Cat.No.: AP2S1-90HFL
• Product Overview: Recombinant protein of human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17 with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-142 aa
• Description: One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 16.8 kDa
• AASequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: >0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: AP2S1 adaptor-related protein complex 2, sigma 1 subunit [ Homo sapiens (human) ]
• Official Symbol: AP2S1
• Synonyms: AP2S1; adaptor-related protein complex 2, sigma 1 subunit; CLAPS2; AP-2 complex subunit sigma; sigma2-adaptin; HA2 17 kDa subunit; clathrin coat assembly protein AP17; clathrin coat-associated protein AP17; clathrin assembly protein 2 small chain; adaptor protein complex AP-2 subunit sigma; plasma membrane adaptor AP-2 17 kDa protein; adapter-related protein complex 2 sigma subunit; clathrin-associated/assembly/adaptor protein, small 2 (17kD); AP17; AP17-DELTA
• Gene ID: 1175
• mRNA Refseq: NM_004069
• Protein Refseq: NP_004060
• MIM: 602242
• UniProt ID: P53680