Recombinant Full Length Human ARF6 Protein, C-Flag-tagged

Cat.No. : ARF6-2128HFL
Product Overview : Recombinant Full Length Human ARF6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 19.9 kDa
AA Sequence : MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKI RPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLG LTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Endocytosis, Fc gamma R-mediated phagocytosis
Full Length : Full L.
Gene Name ARF6 ADP ribosylation factor 6 [ Homo sapiens (human) ]
Official Symbol ARF6
Synonyms DKFZp564M0264
Gene ID 382
mRNA Refseq NM_001663.4
Protein Refseq NP_001654.1
MIM 600464
UniProt ID P62330

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARF6 Products

Required fields are marked with *

My Review for All ARF6 Products

Required fields are marked with *

0
cart-icon