Recombinant Full Length Human ARHGEF2 Protein, C-Flag-tagged

Cat.No. : ARHGEF2-12HFL
Product Overview : Recombinant Full Length Human ARHGEF2 Protein, fused to Flag-tag at C-terminus, was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Protein Length : Full Length
Description : Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified.
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
Molecular Mass : 108.1 kDa
AA Sequence : MKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage : Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Concentration : >0.05 μg/μL as determined by microplate BCA method.
Gene Name ARHGEF2 Rho/Rac guanine nucleotide exchange factor 2 [ Homo sapiens (human) ]
Official Symbol ARHGEF2
Synonyms GEF; Lfc; P40; GEFH1; LFP40; GEF-H1; NEDMHM
Gene ID 9181
mRNA Refseq NM_004723.4
Protein Refseq NP_004714.2 
MIM 607560
UniProt ID Q92974

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF2 Products

Required fields are marked with *

My Review for All ARHGEF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon