Recombinant Full Length Human ARRDC1-AS1 Protein, GST-tagged
Cat.No. : | ARRDC1-AS1-2697HF |
Product Overview : | Human ARRDC1-AS1 full-length ORF (NP_116326.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 176 amino acids |
Description : | This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
Molecular Mass : | 44.4 kDa |
AA Sequence : | MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ] |
Official Symbol | ARRDC1-AS1 |
Synonyms | ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; ARRDC1 Antisense RNA 1; Chromosome 9 Open Reading Frame 37; ARRDC1 Antisense Gene Protein 1; AD038 |
Gene ID | 85026 |
mRNA Refseq | NM_032937 |
Protein Refseq | NP_116326 |
UniProt ID | Q9H2J1 |
◆ Recombinant Proteins | ||
ARRDC1-AS1-1866H | Recombinant Human ARRDC1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARRDC1-AS1-0198H | Recombinant Human ARRDC1-AS1 Protein, GST-Tagged | +Inquiry |
ARRDC1-AS1-2697HF | Recombinant Full Length Human ARRDC1-AS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRDC1-AS1 Products
Required fields are marked with *
My Review for All ARRDC1-AS1 Products
Required fields are marked with *