Recombinant Human ARRDC1-AS1 Protein, GST-Tagged
| Cat.No. : | ARRDC1-AS1-0198H |
| Product Overview : | Human ARRDC1-AS1 full-length ORF (NP_116326.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-176 a.a. |
| Description : | This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
| Molecular Mass : | 44.4 kDa |
| AA Sequence : | MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ] |
| Official Symbol | ARRDC1-AS1 |
| Synonyms | ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; ARRDC1 Antisense RNA 1; Chromosome 9 Open Reading Frame 37; ARRDC1 Antisense Gene Protein 1; AD038 |
| Gene ID | 85026 |
| mRNA Refseq | NM_032937 |
| Protein Refseq | NP_116326 |
| UniProt ID | Q9H2J1 |
| ◆ Recombinant Proteins | ||
| ARRDC1-AS1-2697HF | Recombinant Full Length Human ARRDC1-AS1 Protein, GST-tagged | +Inquiry |
| ARRDC1-AS1-1866H | Recombinant Human ARRDC1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARRDC1-AS1-0198H | Recombinant Human ARRDC1-AS1 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRDC1-AS1 Products
Required fields are marked with *
My Review for All ARRDC1-AS1 Products
Required fields are marked with *
