Recombinant Human ARRDC1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARRDC1-AS1-1866H |
Product Overview : | C9orf37 MS Standard C13 and N15-labeled recombinant protein (NP_116326) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 18 kDa |
AA Sequence : | MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ] |
Official Symbol | ARRDC1-AS1 |
Synonyms | ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; AD038 |
Gene ID | 85026 |
mRNA Refseq | NM_032937 |
Protein Refseq | NP_116326 |
UniProt ID | Q9H2J1 |
◆ Recombinant Proteins | ||
ARRDC1-AS1-0198H | Recombinant Human ARRDC1-AS1 Protein, GST-Tagged | +Inquiry |
ARRDC1-AS1-2697HF | Recombinant Full Length Human ARRDC1-AS1 Protein, GST-tagged | +Inquiry |
ARRDC1-AS1-1866H | Recombinant Human ARRDC1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRDC1-AS1 Products
Required fields are marked with *
My Review for All ARRDC1-AS1 Products
Required fields are marked with *