Recombinant Human ARRDC1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARRDC1-AS1-1866H
Product Overview : C9orf37 MS Standard C13 and N15-labeled recombinant protein (NP_116326) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants.
Molecular Mass : 18 kDa
AA Sequence : MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ]
Official Symbol ARRDC1-AS1
Synonyms ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; AD038
Gene ID 85026
mRNA Refseq NM_032937
Protein Refseq NP_116326
UniProt ID Q9H2J1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARRDC1-AS1 Products

Required fields are marked with *

My Review for All ARRDC1-AS1 Products

Required fields are marked with *

0
cart-icon