Recombinant Full Length Human ATP6V0C Protein, C-Flag-tagged
Cat.No. : | ATP6V0C-2129HFL |
Product Overview : | Recombinant Full Length Human ATP6V0C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV LGLYGLIVALILSTK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Full Length : | Full L. |
Gene Name | ATP6V0C ATPase H+ transporting V0 subunit c [ Homo sapiens (human) ] |
Official Symbol | ATP6V0C |
Synonyms | ATPL; VATL; VPPC; Vma3; ATP6C; ATP6L |
Gene ID | 527 |
mRNA Refseq | NM_001694.4 |
Protein Refseq | NP_001685.1 |
MIM | 108745 |
UniProt ID | P27449 |
◆ Recombinant Proteins | ||
ATP6V0C-5306C | Recombinant Chicken ATP6V0C | +Inquiry |
RFL3341BF | Recombinant Full Length Bovine V-Type Proton Atpase 16 Kda Proteolipid Subunit(Atp6V0C) Protein, His-Tagged | +Inquiry |
Atp6v0c-678M | Recombinant Mouse Atp6v0c Protein, MYC/DDK-tagged | +Inquiry |
ATP6V0C-405H | Recombinant Human ATP6V0C Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V0C-996H | Recombinant Human ATP6V0C protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V0C-8589HCL | Recombinant Human ATP6V0C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V0C Products
Required fields are marked with *
My Review for All ATP6V0C Products
Required fields are marked with *
0
Inquiry Basket