Recombinant Full Length Human BAIAP2 Protein transcript variant 2, C-Myc/DDK-tagged
Cat.No. : | BAIAP2-13HFL |
Product Overview : | Recombinant Full Length Human BAIAP2 Protein transcript variant 2, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 µg/µL as determined by microplate BCA method |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Adherens junction, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | BAIAP2 BAR/IMD domain containing adaptor protein 2 [ Homo sapiens (human) ] |
Official Symbol | BAIAP2 |
Synonyms | BAP2; WAML; FLAF3; IRSP53 |
Gene ID | 10458 |
mRNA Refseq | NM_001385127.1 |
Protein Refseq | NP_001372056.1 |
MIM | 605475 |
UniProt ID | Q9UQB8 |
◆ Recombinant Proteins | ||
BAIAP2-935R | Recombinant Rat BAIAP2 Protein | +Inquiry |
BAIAP2-3421H | Recombinant Human BAIAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BAIAP2-13HFL | Recombinant Full Length Human BAIAP2 Protein transcript variant 2, C-Myc/DDK-tagged | +Inquiry |
BAIAP2-593R | Recombinant Rat BAIAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAIAP2-3866H | Recombinant Human BAIAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAIAP2-8521HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
BAIAP2-8522HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAIAP2 Products
Required fields are marked with *
My Review for All BAIAP2 Products
Required fields are marked with *
0
Inquiry Basket