Recombinant Human BAIAP2 protein, GST-tagged
Cat.No. : | BAIAP2-301317H |
Product Overview : | Recombinant Human BAIAP2 (1-300 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asn300 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | BAIAP2 BAI1-associated protein 2 [ Homo sapiens ] |
Official Symbol | BAIAP2 |
Synonyms | BAIAP2; BAI1-associated protein 2; brain-specific angiogenesis inhibitor 1-associated protein 2; BAP2; IRS-58; IRSp53/58; fas ligand-associated factor 3; insulin receptor substrate p53/p58; insulin receptor substrate protein of 53 kDa; FLAF3; IRSP53; |
Gene ID | 10458 |
mRNA Refseq | NM_001144888 |
Protein Refseq | NP_001138360 |
MIM | 605475 |
UniProt ID | Q9UQB8 |
◆ Recombinant Proteins | ||
BAIAP2-27437TH | Recombinant Human BAIAP2, His-tagged | +Inquiry |
BAIAP2-1373H | Recombinant Human BAI1-Associated Protein 2, His-tagged | +Inquiry |
BAIAP2-1806HF | Recombinant Full Length Human BAIAP2 Protein, GST-tagged | +Inquiry |
BAIAP2-935R | Recombinant Rat BAIAP2 Protein | +Inquiry |
BAIAP2-12HFL | Recombinant Full Length Human BAIAP2 Protein transcript variant 1, C-Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAIAP2-8521HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
BAIAP2-8522HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAIAP2 Products
Required fields are marked with *
My Review for All BAIAP2 Products
Required fields are marked with *
0
Inquiry Basket