Recombinant Full Length Human C-C Motif Chemokine 22(Ccl22) Protein, His-Tagged
Cat.No. : | RFL25261HF |
Product Overview : | Recombinant Full Length Human C-C motif chemokine 22(CCL22) Protein (O75078) (226-769aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (226-769) |
Form : | Lyophilized powder |
AA Sequence : | QVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADAM11 |
Synonyms | ADAM11; MDC; Disintegrin and metalloproteinase domain-containing protein 11; ADAM 11; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein; MDC |
UniProt ID | O75078 |
◆ Recombinant Proteins | ||
ADAM11-273H | Recombinant Human ADAM11 Protein, GST-tagged | +Inquiry |
ADAM11-1150H | Recombinant Human ADAM11 Protein, MYC/DDK-tagged | +Inquiry |
ADAM11-734HFL | Recombinant Full Length Human ADAM11 Protein, C-Flag-tagged | +Inquiry |
Adam11-534M | Recombinant Mouse Adam11 Protein, MYC/DDK-tagged | +Inquiry |
ADAM11-5276H | Recombinant Human ADAM11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM11 Products
Required fields are marked with *
My Review for All ADAM11 Products
Required fields are marked with *
0
Inquiry Basket