Recombinant Human ADAM11 Protein, GST-tagged

Cat.No. : ADAM11-273H
Product Overview : Human ADAM11 partial ORF ( NP_002381, 230 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. This gene represents a candidate tumor suppressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]
Molecular Mass : 37.18 kDa
AA Sequence : GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAM11 ADAM metallopeptidase domain 11 [ Homo sapiens ]
Official Symbol ADAM11
Synonyms ADAM11; ADAM metallopeptidase domain 11; a disintegrin and metalloproteinase domain 11 , MDC; disintegrin and metalloproteinase domain-containing protein 11; metalloproteinase like; disintegrin like; cysteine rich protein; ADAM 11; MDC;
Gene ID 4185
mRNA Refseq NM_002390
Protein Refseq NP_002381
MIM 155120
UniProt ID O75078

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAM11 Products

Required fields are marked with *

My Review for All ADAM11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon