Recombinant Human ADAM11 Protein, GST-tagged
| Cat.No. : | ADAM11-273H |
| Product Overview : | Human ADAM11 partial ORF ( NP_002381, 230 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. This gene represents a candidate tumor suppressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
| Molecular Mass : | 37.18 kDa |
| AA Sequence : | GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAM11 ADAM metallopeptidase domain 11 [ Homo sapiens ] |
| Official Symbol | ADAM11 |
| Synonyms | ADAM11; ADAM metallopeptidase domain 11; a disintegrin and metalloproteinase domain 11 , MDC; disintegrin and metalloproteinase domain-containing protein 11; metalloproteinase like; disintegrin like; cysteine rich protein; ADAM 11; MDC; |
| Gene ID | 4185 |
| mRNA Refseq | NM_002390 |
| Protein Refseq | NP_002381 |
| MIM | 155120 |
| UniProt ID | O75078 |
| ◆ Recombinant Proteins | ||
| ADAM11-273H | Recombinant Human ADAM11 Protein, GST-tagged | +Inquiry |
| RFL25261HF | Recombinant Full Length Human C-C Motif Chemokine 22(Ccl22) Protein, His-Tagged | +Inquiry |
| ADAM11-279H | Recombinant Human ADAM11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADAM11-5276H | Recombinant Human ADAM11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ADAM11-734HFL | Recombinant Full Length Human ADAM11 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM11 Products
Required fields are marked with *
My Review for All ADAM11 Products
Required fields are marked with *



