Recombinant Full Length Human C10orf82 Protein, GST-tagged
| Cat.No. : | C10orf82-1785HF |
| Product Overview : | Human C10orf82 full-length ORF ( NP_653262.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 154 amino acids |
| Description : | C10orf82 (Chromosome 10 Open Reading Frame 82) is a Protein Coding gene. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 44.2 kDa |
| AA Sequence : | MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens ] |
| Official Symbol | C10orf82 |
| Synonyms | C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268 |
| Gene ID | 143379 |
| mRNA Refseq | NM_144661 |
| Protein Refseq | NP_653262 |
| UniProt ID | Q8WW14 |
| ◆ Recombinant Proteins | ||
| C10orf82-447H | Recombinant Human C10orf82 Protein, GST-tagged | +Inquiry |
| C10orf82-1568H | Recombinant Human C10orf82 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C10orf82-1785HF | Recombinant Full Length Human C10orf82 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C10orf82-8361HCL | Recombinant Human C10orf82 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf82 Products
Required fields are marked with *
My Review for All C10orf82 Products
Required fields are marked with *
